PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539692.1_FGP009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 307aa    MW: 33982 Da    PI: 9.5703
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539692.1_FGP009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.51.9e-32166222158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep++VNaKQy++Il+RRq+Rakle+++k   k+rkpylheSRh+hA++R+RgsgGrF
  KN539692.1_FGP009 166 EEPIFVNAKQYNAILRRRQTRAKLEAQNKA-VKGRKPYLHESRHRHAMKRARGSGGRF 222
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-35164225IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.46165225IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.6E-28167222IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-23168190IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860170190IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-23199222IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MENHPVQCMA KTNYDFLARN NYPMKQLVQR NSDGDSSPTK SGQSHQEASA VSDSSLNGQH  60
TSPQSELTKY DLTQIVFVPS DINNNDSCGE RDHGTKSVLS LGNTEAAFPP SKFDYNQPFA  120
CVSYPYGTDP YYGGVLTGYT SHAFVHPQIT GAANSRMPLP VDPSVEEPIF VNAKQYNAIL  180
RRRQTRAKLE AQNKAVKGRK PYLHESRHRH AMKRARGSGG RFLTKKELLE QQQQQQQKPP  240
PASAQSPTVL QVHMVIGNNR SNPQFVANPL RPIFDARLVA ESSEQMCKTG NPVPGFLTNS  300
PTLALTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-22165227163NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206215RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0621350.0AK062135.1 Oryza sativa Japonica Group cDNA clone:001-045-F05, full insert sequence.
GenBankEU8470110.0EU847011.1 Oryza sativa Japonica Group clone KCS132A05 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631980.11e-165PREDICTED: nuclear transcription factor Y subunit A-4
TrEMBLA0A0D9Z8T61e-167A0A0D9Z8T6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GJE21e-167A0A0E0GJE2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NWG01e-167A0A0E0NWG0_ORYRU; Uncharacterized protein
STRINGORGLA03G0197400.11e-166(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.16e-37nuclear factor Y, subunit A6